PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00238_0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 332aa    MW: 36600.8 Da    PI: 6.6202
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00238_0070genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-1081127448
                      S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48 
                      WT+ E +l+ +a +++G +   +W+ Ia  ++ g+t+ ++k ++ ++l
    kfl00238_0070  81 WTPSENKLFENALNMYGEEdeaRWNNIAGQVP-GKTPDEVKRKYEQLL 127
                      ********************************.***********8875 PP

2Myb_DNA-binding40.75.4e-13195239347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
    kfl00238_0070 195 AWSEEEHRLFLLGLAKFGKGDWRSISRNFVVSRTPTQVASHAQKY 239
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.17776131IPR017884SANT domain
SMARTSM007176.6E-977129IPR001005SANT/Myb domain
SuperFamilySSF466896.49E-1180134IPR009057Homeodomain-like
CDDcd001671.18E-981127No hitNo description
Gene3DG3DSA:1.10.10.604.5E-781128IPR009057Homeodomain-like
PfamPF002491.6E-981127IPR001005SANT/Myb domain
PROSITE profilePS5129416.482188244IPR017930Myb domain
SuperFamilySSF466898.28E-16190245IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-16192242IPR006447Myb domain, plants
SMARTSM007172.2E-10192242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-10195238IPR009057Homeodomain-like
CDDcd001671.25E-9195240No hitNo description
PfamPF002498.2E-11195239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEQEPALGMQ TEENEKKEVK AVKWENEAAS PQLMTSPETS SQGLDSSDLG SEPHFFDNGS  60
IHMRFGDDGV SSGHAGDLSG WTPSENKLFE NALNMYGEED EARWNNIAGQ VPGKTPDEVK  120
RKYEQLLEDV RAIESGRVPV IAYGDPHKQT ASEEEMMRDD VGNGVEMAMP ASPGGTRRPK  180
VGQRSSEQER RKGIAWSEEE HRLFLLGLAK FGKGDWRSIS RNFVVSRTPT QVASHAQKYF  240
IRLNSISKDK RRNSIHDITS VNGQGGHGPS QRGIGGHPPI APNLHPGQNM YGHHMMMNPG  300
HMRPMGPPMG VPVNHMGGPP HMQPYVTTGG HQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-15811591189RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754431.13e-68predicted protein, partial
SwissprotQ8S9H73e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB8LKB71e-68B8LKB7_PICSI; Putative uncharacterized protein
STRINGPP1S13_201V6.14e-65(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-52MYB family protein